RetrogeneDB ID: | retro_ptro_729 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 12:2866709..2867003(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CBX3 | ||
Ensembl ID: | ENSPTRG00000019003 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 79.59 % |
Parental protein coverage: | 53.55 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | NLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGE |
NL.CPELIEAFLNSQKAGKEKDGTKRKS.S.SESD.SKS.KKRDAADKPRGFA.GLDP.R.IGATD.SG. | |
Retrocopy | NLICPELIEAFLNSQKAGKEKDGTKRKSVSHSESDVSKSQKKRDAADKPRGFATGLDPKRVIGATDGSGK |
Parental | LMFLMKWKDSDEADLVLAKEANMKCPQI |
.MFLM.WKDS.EAD..LAKEA.M...Q. | |
Retrocopy | WMFLMRWKDSGEADFMLAKEASMQFSQL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 30 .19 RPM |
SRP007412_cerebellum | 0 .04 RPM | 17 .71 RPM |
SRP007412_heart | 0 .03 RPM | 22 .38 RPM |
SRP007412_kidney | 0 .03 RPM | 31 .98 RPM |
SRP007412_liver | 0 .03 RPM | 21 .93 RPM |
SRP007412_testis | 1 .16 RPM | 73 .66 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1071 |
Gorilla gorilla | retro_ggor_845 |
Pongo abelii | retro_pabe_892 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000002897 | 11 retrocopies | |
Callithrix jacchus | ENSCJAG00000007952 | 8 retrocopies | |
Loxodonta africana | ENSLAFG00000006907 | 3 retrocopies | |
Mus musculus | ENSMUSG00000029836 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000016583 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000011713 | 9 retrocopies | |
Pan troglodytes | ENSPTRG00000005034 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000019003 | 10 retrocopies |
retro_ptro_17, retro_ptro_1706, retro_ptro_1875, retro_ptro_2289, retro_ptro_2475, retro_ptro_395, retro_ptro_537, retro_ptro_630, retro_ptro_729 , retro_ptro_780,
|
Pteropus vampyrus | ENSPVAG00000006297 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000011814 | 2 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000017913 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000016711 | 4 retrocopies |