RetrogeneDB ID: | retro_ggor_845 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 12:2868537..2868831(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CBX3 | ||
Ensembl ID: | ENSGGOG00000025853 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 77.55 % |
Parental protein coverage: | 53.55 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | NLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGE |
NL.CPELIEAFLNSQKAGKEKDG.KRKS.S.SESD.SKS.KKRDAADKPRGFA.GLDPER.IGA.D.SG. | |
Retrocopy | NLTCPELIEAFLNSQKAGKEKDGSKRKSVSHSESDVSKSQKKRDAADKPRGFATGLDPERVIGARDGSGK |
Parental | LMFLMKWKDSDEADLVLAKEANMKCPQI |
.MFLM.WKDS.EA...LAKEA.M...Q. | |
Retrocopy | WMFLMRWKDSGEAVFMLAKEASMQFSQL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 24 .31 RPM |
SRP007412_cerebellum | 0 .00 RPM | 19 .46 RPM |
SRP007412_heart | 0 .00 RPM | 5 .22 RPM |
SRP007412_kidney | 0 .00 RPM | 38 .68 RPM |
SRP007412_liver | 0 .00 RPM | 24 .45 RPM |
SRP007412_testis | 0 .41 RPM | 88 .58 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1071 |
Pan troglodytes | retro_ptro_729 |
Pongo abelii | retro_pabe_892 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000005969 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000002897 | 11 retrocopies | |
Callithrix jacchus | ENSCJAG00000007952 | 8 retrocopies | |
Gorilla gorilla | ENSGGOG00000000041 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000024063 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000025853 | 6 retrocopies |
retro_ggor_1928, retro_ggor_2281, retro_ggor_2466, retro_ggor_2467, retro_ggor_635, retro_ggor_845 ,
|
Loxodonta africana | ENSLAFG00000006907 | 3 retrocopies | |
Mus musculus | ENSMUSG00000029836 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000016583 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000011713 | 9 retrocopies | |
Rattus norvegicus | ENSRNOG00000011814 | 2 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000017913 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000016711 | 4 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000006223 | 4 retrocopies |