RetrogeneDB ID: | retro_fcat_1269 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
Coordinates: | C2:53893657..53893892(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PIGP | ||
Ensembl ID: | ENSFCAG00000028400 | ||
Aliases: | None | ||
Description: | phosphatidylinositol glycan anchor biosynthesis, class P [Source:HGNC Symbol;Acc:3046] |
Percent Identity: | 72.5 % |
Parental protein coverage: | 53.02 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | PETWLNSLGLTYWPQKYWAIALPVYLLITIVIGYVLLFGINMMSTSPLNSIHTITDNYA-KNQQRKNYQE |
P..WLNS.G.TYWPQKYWA.ALPV.L.ITI.I.YV.L...N..STSPLNSIHTITDNY..KNQQ.K.YQE | |
Retrocopy | PDSWLNS*GSTYWPQKYWAVALPVILFITIGIDYVSLIRTN-ISTSPLNSIHTITDNYV>KNQQ*KKYQE |
Parental | EAIPALRDIP |
E.I.ALRD.P | |
Retrocopy | EVIRALRDSP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 13 .31 RPM |
SRP017611_kidney | 0 .00 RPM | 12 .99 RPM |
SRP017611_liver | 0 .00 RPM | 7 .78 RPM |