RetrogeneDB ID: | retro_ggor_1017 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 14:311802..312177(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DUXA | ||
| Ensembl ID: | ENSGGOG00000005650 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 77.17 % |
| Parental protein coverage: | 61.27 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 2 |
| Parental | TLESSQSQGQDQPGVEFQSREARRCRTTYSASQLHTLIKAFMKNPYPGIDSREELAKEIGVPESRVQIWF |
| TL..S.S.GQD.P.VEFQ.REAR.CRTTYS..QLHT.I.AFMKNPYPGIDSRE.LA.EIG.PESRVQIWF | |
| Retrocopy | TLDLSHSHGQD*PCVEFQNREAR*CRTTYSTFQLHTVIHAFMKNPYPGIDSREQLAEEIGAPESRVQIWF |
| Parental | QNRRSRLLLQRKREPVASLEQEEQ-GKIPEGLQGTEDTQNGTNFTS-DSHFSGARTW |
| QN.RSR..LQRKREPV.SLE.E.Q.GK..EGLQGTEDTQNGT..TS..SHFS.ARTW | |
| Retrocopy | QN*RSRFHLQRKREPVMSLE*EHQ>GKVSEGLQGTEDTQNGTSLTS<HSHFSRARTW |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .14 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .08 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .10 RPM | 0 .10 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000025505 | 1 retrocopy | |
| Felis catus | ENSFCAG00000007545 | 1 retrocopy | |
| Homo sapiens | ENSG00000258873 | 5 retrocopies | |
| Gorilla gorilla | ENSGGOG00000005650 | 7 retrocopies |
retro_ggor_1017 , retro_ggor_1076, retro_ggor_1167, retro_ggor_1528, retro_ggor_2133, retro_ggor_2752, retro_ggor_510,
|
| Loxodonta africana | ENSLAFG00000030167 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000007788 | 5 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000010886 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000011331 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000010457 | 8 retrocopies | |
| Pan troglodytes | ENSPTRG00000028871 | 5 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000003020 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000005321 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000014223 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000014200 | 2 retrocopies |