RetrogeneDB ID: | retro_nleu_1935 | ||
Retrocopylocation | Organism: | Gibbon (Nomascus leucogenys) | |
Coordinates: | GL397317.1:9657803..9658235(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | DUXA | ||
Ensembl ID: | ENSNLEG00000010886 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 82.99 % |
Parental protein coverage: | 73.13 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MAEDTYSHKMVTANRRRCRTKFTEDQLKILINTFNQKPYPGYATKQKLALEINTEESRIQIWFQNRRARH |
MAEDT.SHKMVT.N.RR..TKFT.DQLKILINTFNQKPYPGYATKQKLALEINTEESRIQIWFQNRRAR. | |
Retrocopy | MAEDTSSHKMVTTNHRRSLTKFT-DQLKILINTFNQKPYPGYATKQKLALEINTEESRIQIWFQNRRAR- |
Parental | GFQKRPEAETLESSQSQGQDQPGVEFQSREARRCRTTYSATQLHTLIEAFMKNPYPGIDSREELAKEIGV |
.FQKRPE..TLESSQS.GQD.P..EFQSREAR.C.TTYS..QL.TLI.AFMKNPYPGIDSRE.LA.EIG. | |
Retrocopy | -FQKRPESGTLESSQSHGQDRPDAEFQSREARWCCTTYSTSQLSTLIKAFMKNPYPGIDSREQLAEEIGI |
Parental | PESRVQV |
PESRV.. | |
Retrocopy | PESRVPI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Dasypus novemcinctus | ENSDNOG00000025505 | 1 retrocopy | |
Felis catus | ENSFCAG00000007545 | 1 retrocopy | |
Homo sapiens | ENSG00000258873 | 5 retrocopies | |
Gorilla gorilla | ENSGGOG00000005650 | 7 retrocopies | |
Loxodonta africana | ENSLAFG00000030167 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000007788 | 5 retrocopies | |
Nomascus leucogenys | ENSNLEG00000010886 | 3 retrocopies |
retro_nleu_1935 , retro_nleu_2214, retro_nleu_568,
|
Nomascus leucogenys | ENSNLEG00000016146 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000011331 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000010457 | 8 retrocopies | |
Pan troglodytes | ENSPTRG00000028871 | 5 retrocopies | |
Pteropus vampyrus | ENSPVAG00000003020 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000005321 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000014223 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000014200 | 2 retrocopies |