RetrogeneDB ID: | retro_mmus_1290 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 14:72840721..72841150(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Ndufaf4 | ||
| Ensembl ID: | ENSMUSG00000028261 | ||
| Aliases: | Ndufaf4, 1110007M04Rik, 3000003G13Rik, AW214064 | ||
| Description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 4 [Source:MGI Symbol;Acc:MGI:1915743] |
| Percent Identity: | 52.38 % |
| Parental protein coverage: | 82.08 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 4 |
| Parental | KHPSTRDLLQEHRSQYPEIEEVVSKKDNKLLSL-LRDVYVDSKDPVPALPVK-VEPRQEPKEFRLPIGNH |
| KH.....LL.......PEI.EV..K....L..L.....YVD.K.....L.VK..EP.QEPKEFRL.I..H | |
| Retrocopy | KHSYPCSLLSKQLRHHPEIKEVARKGKKLLSLL<KQCIYVDPKVLASSLQVKDIEP*QEPKEFRLEI*HH |
| Parental | FDKNITDIPKGK-ITVVEALTLLNNHKLSPETWTAEK-IAQEYYLELKDVNSLLKYFVTFEV-KILPPED |
| FD.NI....KGK.IT..E.LTLLNNH..S.E..TA.K....E.YLELK.VNSLL.Y.VTF.V.KI.P.E. | |
| Retrocopy | FDMNIMGVSKGK<ITIIEVLTLLNNHTFSQERQTAGK>TTKEFYLELKYVNSLLNYLVTFNV>KIFPFEE |
| Parental | RKAIQSK |
| .K.I.SK | |
| Retrocopy | KKVI*SK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 24 .95 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 18 .58 RPM |
| SRP007412_heart | 0 .00 RPM | 39 .22 RPM |
| SRP007412_kidney | 0 .00 RPM | 30 .09 RPM |
| SRP007412_liver | 0 .00 RPM | 24 .77 RPM |
| SRP007412_testis | 0 .09 RPM | 2 .10 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000003174 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000005145 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000001235 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000007618 | 1 retrocopy | |
| Homo sapiens | ENSG00000123545 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000012070 | 4 retrocopies | |
| Microcebus murinus | ENSMICG00000015734 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000018843 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000028261 | 3 retrocopies |
retro_mmus_1153, retro_mmus_1290 , retro_mmus_3668,
|
| Nomascus leucogenys | ENSNLEG00000013568 | 4 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000002152 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000016857 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000018435 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000007506 | 3 retrocopies | |
| Tursiops truncatus | ENSTTRG00000010911 | 1 retrocopy |