RetrogeneDB ID: | retro_sscr_779 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
Coordinates: | 4:55440273..55440659(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSSSCG00000025751 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 73.08 % |
Parental protein coverage: | 79.14 % |
Number of stop codons detected: | 4 |
Number of frameshifts detected | 1 |
Parental | SEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIAT |
SEPIRVLVTGA.G.IAYSLL..IGNGSVFGK.QPIIL.L.D..PMMG.LDGVLME.QDC..PLLKD.I.T | |
Retrocopy | SEPIRVLVTGATG*IAYSLL*CIGNGSVFGKHQPIILELVDFMPMMGILDGVLMEQQDCTHPLLKDIITT |
Parental | DKEEIAFKDLDVAILVGSMPRRDGMERKD-LLKANVKIFKCQGAALDKYAKKSVKVYRGG |
D..EIAFK.LDV.IL...MP....M..KD.LLKAN.KIFKCQGA.L.KYAKKSV..Y.GG | |
Retrocopy | DRKEIAFKSLDVIILMSFMP*TYWMQTKD<LLKANMKIFKCQGATLEKYAKKSV*GYCGG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP014902_placenta | 0 .00 RPM | 13 .67 RPM |
SRP014902_testis | 0 .00 RPM | 26 .31 RPM |
SRP018288_heart | 0 .00 RPM | 161 .06 RPM |
SRP018288_kidney | 0 .00 RPM | 85 .90 RPM |
SRP018288_liver | 0 .00 RPM | 21 .11 RPM |
SRP018288_lung | 0 .00 RPM | 9 .06 RPM |
SRP018856_adipose | 0 .00 RPM | 80 .77 RPM |
SRP035408_brain | 0 .00 RPM | 71 .52 RPM |
SRP035408_liver | 0 .00 RPM | 40 .22 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000019295 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000007281 | 5 retrocopies | |
Callithrix jacchus | ENSCJAG00000007018 | 4 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000013329 | 2 retrocopies | |
Homo sapiens | ENSG00000014641 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000007085 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000016504 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000006163 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000009823 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000014487 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000012373 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000011974 | 1 retrocopy | |
Sorex araneus | ENSSARG00000007690 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000025751 | 1 retrocopy |
retro_sscr_779 ,
|
Tarsius syrichta | ENSTSYG00000001215 | 2 retrocopies |