RetrogeneDB ID: | retro_cfam_1465 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
Coordinates: | 32:12743757..12743966(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SUI1ISO1 | ||
Ensembl ID: | ENSCAFG00000029584 | ||
Aliases: | EIF1, SUI1ISO1 | ||
Description: | None |
Percent Identity: | 76.06 % |
Parental protein coverage: | 61.95 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | LTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQF-LVEIGLAKDDQLKVHG |
L.TVQG.A.DYDKK.LVK.FKKKFACNGT..EHPEYGEVIQLQGDQ.KN.C.F.L..IGLA.DD.LK..G | |
Retrocopy | LLTVQGMANDYDKKTLVKVFKKKFACNGTAAEHPEYGEVIQLQGDQCKNMCRF<LLDIGLANDDPLKLMG |
Parental | F |
F | |
Retrocopy | F |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012049_cerebellum | 0 .00 RPM | 272 .07 RPM |
SRP017611_brain | 0 .00 RPM | 252 .39 RPM |
SRP017611_kidney | 0 .00 RPM | 337 .32 RPM |
SRP017611_liver | 0 .00 RPM | 159 .24 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000005620 | 9 retrocopies | |
Canis familiaris | ENSCAFG00000029584 | 4 retrocopies | |
Callithrix jacchus | ENSCJAG00000012120 | 6 retrocopies | |
Cavia porcellus | ENSCPOG00000014350 | 3 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000007856 | 11 retrocopies | |
Dipodomys ordii | ENSDORG00000013853 | 4 retrocopies | |
Homo sapiens | ENSG00000173812 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000027201 | 2 retrocopies | |
Macropus eugenii | ENSMEUG00000015360 | 6 retrocopies | |
Myotis lucifugus | ENSMLUG00000005077 | 3 retrocopies | |
Otolemur garnettii | ENSOGAG00000031577 | 6 retrocopies | |
Pongo abelii | ENSPPYG00000029667 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000033765 | 15 retrocopies | |
Sorex araneus | ENSSARG00000006287 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000005729 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000017430 | 6 retrocopies | |
Tursiops truncatus | ENSTTRG00000017135 | 3 retrocopies |