RetrogeneDB ID: | retro_ggor_1251 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 16:2988970..2989308(-) | ||
Located in intron of: | ENSGGOG00000015312 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | EIF1 | ||
Ensembl ID: | ENSGGOG00000027201 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 78.95 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | MSAIQNLHS-FDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFAC |
MS..QNLHS.F.PFAD.SK.DDLLPAGTE.YIH.RI.Q.N.RKTL.TV..I..DY.KK.LVKAFK.KF.C | |
Retrocopy | MSTVQNLHS<FHPFADLSKSDDLLPAGTEEYIHARI*QTNDRKTLSTV*AITKDYNKKQLVKAFKRKFTC |
Parental | NGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF |
NGTVIEHPEYGEVIQLQGDQRKNI.QFLVE.GLAKDDQL.V.GF | |
Retrocopy | NGTVIEHPEYGEVIQLQGDQRKNIRQFLVEVGLAKDDQLMVQGF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 186 .59 RPM |
SRP007412_cerebellum | 0 .00 RPM | 217 .44 RPM |
SRP007412_heart | 0 .00 RPM | 123 .30 RPM |
SRP007412_kidney | 0 .00 RPM | 324 .00 RPM |
SRP007412_liver | 0 .00 RPM | 286 .99 RPM |
SRP007412_testis | 0 .00 RPM | 324 .16 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000005620 | 9 retrocopies | |
Canis familiaris | ENSCAFG00000029584 | 4 retrocopies | |
Callithrix jacchus | ENSCJAG00000012120 | 6 retrocopies | |
Cavia porcellus | ENSCPOG00000014350 | 3 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000007856 | 11 retrocopies | |
Dipodomys ordii | ENSDORG00000013853 | 4 retrocopies | |
Homo sapiens | ENSG00000173812 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000027201 | 2 retrocopies |
retro_ggor_1251 , retro_ggor_318,
|
Macropus eugenii | ENSMEUG00000015360 | 6 retrocopies | |
Myotis lucifugus | ENSMLUG00000005077 | 3 retrocopies | |
Otolemur garnettii | ENSOGAG00000031577 | 6 retrocopies | |
Pongo abelii | ENSPPYG00000029667 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000033765 | 15 retrocopies | |
Sorex araneus | ENSSARG00000006287 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000005729 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000017430 | 6 retrocopies | |
Tursiops truncatus | ENSTTRG00000017135 | 3 retrocopies |