RetrogeneDB ID: | retro_mmul_1933 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 5:12379315..12379627(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.17961 | ||
| Ensembl ID: | ENSMMUG00000003073 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 75.0 % |
| Parental protein coverage: | 54.69 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 3 |
| Parental | SGTESDSDESVPELEEQDSTQA-TTQQAQLAAAAEIDEEP-VSKAKQSRSEKKARKAMSKLGLRQVTGVT |
| SGTE.D.D.SVPELE..DST...TTQ.AQLAA.AEI.E....SKAKQS.SEKKA.KAMSKLGL...TGVT | |
| Retrocopy | SGTEPDGDKSVPELEDRDSTET<TTQTAQLAAVAEINERQ<ISKAKQS*SEKKACKAMSKLGLP*ITGVT |
| Parental | RVTIR-KSKNILFVITKPDVYKSPASDTYIVFGEAKIE |
| .VT...KSKNI.FVITKPDVYK.PASDTYIVFGEAKI. | |
| Retrocopy | PVTTG<KSKNIFFVITKPDVYKNPASDTYIVFGEAKIK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 132 .22 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 89 .72 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 157 .30 RPM |
| SRP007412_heart | 0 .00 RPM | 188 .14 RPM |
| SRP007412_kidney | 0 .00 RPM | 220 .18 RPM |
| SRP007412_liver | 0 .00 RPM | 130 .11 RPM |
| SRP007412_testis | 0 .00 RPM | 175 .05 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000004175 | 3 retrocopies | |
| Canis familiaris | ENSCAFG00000000141 | 8 retrocopies | |
| Callithrix jacchus | ENSCJAG00000010701 | 8 retrocopies | |
| Dipodomys ordii | ENSDORG00000014522 | 2 retrocopies | |
| Equus caballus | ENSECAG00000015242 | 1 retrocopy | |
| Homo sapiens | ENSG00000196531 | 6 retrocopies | |
| Loxodonta africana | ENSLAFG00000004598 | 6 retrocopies | |
| Macropus eugenii | ENSMEUG00000008412 | 3 retrocopies | |
| Microcebus murinus | ENSMICG00000016465 | 5 retrocopies | |
| Myotis lucifugus | ENSMLUG00000001169 | 16 retrocopies | |
| Macaca mulatta | ENSMMUG00000003073 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000061315 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000001781 | 3 retrocopies | |
| Procavia capensis | ENSPCAG00000007067 | 5 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000002175 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000002150 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000004028 | 2 retrocopies |