RetrogeneDB ID: | retro_fcat_1572 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
Coordinates: | D4:6442670..6442895(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | COX5B | ||
Ensembl ID: | ENSFCAG00000001704 | ||
Aliases: | None | ||
Description: | cytochrome c oxidase subunit Vb [Source:HGNC Symbol;Acc:2269] |
Percent Identity: | 78.95 % |
Parental protein coverage: | 58.91 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | AAQALRVRGPNGVAAVRSMASGGGVPTDDEQATGLEREVMMAARKGLDPYNMLAPKAASGTKEDPNLVPS |
AAQALR..GP.GV..V.S.ASGG.VPTDDEQA..LEREVMMAA.K.LDPYN.LAPKAASGTKE.PNLVPS | |
Retrocopy | AAQALRTCGPKGVTTVCSVASGG-VPTDDEQASRLEREVMMAAQKALDPYNILAPKAASGTKEHPNLVPS |
Parental | ITNKRI |
ITNK.. | |
Retrocopy | ITNKHL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .11 RPM | 105 .94 RPM |
SRP017611_kidney | 0 .00 RPM | 172 .42 RPM |
SRP017611_liver | 0 .10 RPM | 64 .60 RPM |