RetrogeneDB ID: | retro_btau_1018 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
Coordinates: | 23:8427245..8427458(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | COX5B | ||
Ensembl ID: | ENSBTAG00000018542 | ||
Aliases: | None | ||
Description: | Cytochrome c oxidase subunit 5B, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P00428] |
Percent Identity: | 92.96 % |
Parental protein coverage: | 55.04 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MASRLLRGVGALASQALRARGPNGVSVVRSMASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKAT |
MASRLL.G.G.LASQALRARGPNGVSVVRSMASGGG.PTDEEQATGLEREVMLAARKGQDPYN.LAPKAT | |
Retrocopy | MASRLLHGAGVLASQALRARGPNGVSVVRSMASGGGAPTDEEQATGLEREVMLAARKGQDPYNMLAPKAT |
Parental | S |
S | |
Retrocopy | S |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
ERP005899_liver | 0 .07 RPM | 49 .82 RPM |
ERP005899_muscle | 0 .53 RPM | 265 .85 RPM |
SRP017611_brain | 0 .00 RPM | 69 .71 RPM |
SRP017611_kidney | 0 .12 RPM | 163 .35 RPM |
SRP017611_liver | 0 .08 RPM | 77 .17 RPM |
SRP030211_testis | 0 .13 RPM | 65 .26 RPM |