RetrogeneDB ID: | retro_eeur_339 | ||
Retrocopy location | Organism: | Hedgehog (Erinaceus europaeus) | |
| Coordinates: | scaffold_263615:3729..3956(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SNRPE | ||
| Ensembl ID: | ENSEEUG00000006187 | ||
| Aliases: | None | ||
| Description: | small nuclear ribonucleoprotein polypeptide E [Source:HGNC Symbol;Acc:11161] |
| Percent Identity: | 67.53 % |
| Parental protein coverage: | 82.22 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | PINLIFRYLQNRS-RIQVWLYEQVNMRIEGCIIXXXXXXXXXXXDA-EIHSKTKSRKQLG-IMLKGDNIT |
| P..LIFRYLQNRS..IQV.LY.Q.NM..EGCII...........DA.EIHSKTKSRKQ.G.IMLK.DNIT | |
| Retrocopy | PTSLIFRYLQNRS<MIQV*LYVQENMQTEGCIIGFDEYVILVLDDAQEIHSKTKSRKQQGQIMLKRDNIT |
| Parental | LLQSVSN |
| .LQSVSN | |
| Retrocopy | QLQSVSN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 1 .13 RPM |
| SRP017611_kidney | 0 .00 RPM | 1 .88 RPM |
| SRP017611_liver | 0 .00 RPM | 1 .13 RPM |