RetrogeneDB ID: | retro_dnov_1141 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_15267:10740..10950(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSDNOG00000004490 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 68.06 % |
Parental protein coverage: | 76.09 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | LIFRYLQN-RSRIQVWLYEQVNMRIEGCIIGFDEYMNLV-LDDAEEIHSKTKSRKQLGRIMLKGDNITLL |
L.FR.L...RSRIQV...EQVN..IEGC..G.DEYM..V.LDDAEE.HSK.KSRKQLG.I..K..NITLL | |
Retrocopy | LAFRKLKR>RSRIQV*VHEQVNIWIEGCVTGVDEYMDPV<LDDAEERHSKRKSRKQLGQILIKRYNITLL |
Parental | QS |
QS | |
Retrocopy | QS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 23 .92 RPM |
SRP012922_cerebellum | 0 .00 RPM | 12 .51 RPM |
SRP012922_heart | 0 .00 RPM | 8 .59 RPM |
SRP012922_kidney | 0 .00 RPM | 9 .31 RPM |
SRP012922_liver | 0 .00 RPM | 7 .43 RPM |
SRP012922_lung | 0 .00 RPM | 15 .27 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 8 .13 RPM |
SRP012922_spleen | 0 .00 RPM | 24 .15 RPM |