RetrogeneDB ID: | retro_pabe_3620 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | X:24638796..24639026(+) | ||
Located in intron of: | ENSPPYG00000020198 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSPPYG00000000326 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 73.42 % |
Parental protein coverage: | 82.61 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | PINL--IFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIML-KGDN |
PINL..IFRYLQNRSRI.VWLYEQVNM.IEG..IGFDE..NL..DDAEEIH..TK.RK.LG.I.L.KGD. | |
Retrocopy | PINLTFIFRYLQNRSRIHVWLYEQVNMLIEGRVIGFDESVNLISDDAEEIHCETKPRKPLGQIVL<KGDH |
Parental | ITLLQSVSN |
I.L.Q.VSN | |
Retrocopy | I-LPQNVSN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 4 .64 RPM |
SRP007412_cerebellum | 0 .00 RPM | 6 .69 RPM |
SRP007412_heart | 0 .06 RPM | 6 .11 RPM |
SRP007412_kidney | 0 .00 RPM | 7 .96 RPM |
SRP007412_liver | 0 .00 RPM | 6 .49 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_4660 |
Pan troglodytes | retro_ptro_3096 |
Gorilla gorilla | retro_ggor_2892 |
Macaca mulatta | retro_mmul_2480 |