RetrogeneDB ID: | retro_ogar_773 | ||
Retrocopylocation | Organism: | Bushbaby (Otolemur garnettii) | |
Coordinates: | GL873527.1:5981297..5981521(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SNRPE | ||
Ensembl ID: | ENSOGAG00000004309 | ||
Aliases: | None | ||
Description: | small nuclear ribonucleoprotein polypeptide E [Source:HGNC Symbol;Acc:11161] |
Percent Identity: | 78.95 % |
Parental protein coverage: | 98.68 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYE-QVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTK |
.AY.GQGQKVQKVMVQPINLIFRYLQNRSR...WLY..QV.M...GC.IG.DEYMNLVLDDAEEIHSK.K | |
Retrocopy | LAYCGQGQKVQKVMVQPINLIFRYLQNRSRVRLWLYD<QVDM*TRGCVIGVDEYMNLVLDDAEEIHSKIK |
Parental | SRKQLG |
S..QLG | |
Retrocopy | S*RQLG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |