RetrogeneDB ID: | retro_ptro_1345 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 19:5602521..5602746(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SNRPEL1 | ||
Ensembl ID: | ENSPTRG00000030224 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 88. % |
Parental protein coverage: | 81.52 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKS |
MAYRGQGQKVQKVM.QPI.LIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSK... | |
Retrocopy | MAYRGQGQKVQKVMAQPISLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKSQE |
Parental | RKQLG |
....G | |
Retrocopy | NNWVG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 11 .39 RPM |
SRP007412_cerebellum | 0 .00 RPM | 6 .20 RPM |
SRP007412_heart | 0 .00 RPM | 4 .78 RPM |
SRP007412_kidney | 0 .00 RPM | 10 .41 RPM |
SRP007412_liver | 0 .03 RPM | 5 .30 RPM |
SRP007412_testis | 0 .00 RPM | 4 .85 RPM |