RetrogeneDB ID: retro_mdom_1164

Retrocopy location

• Organism: Opossum (Monodelphis domestica)
• Coordinates: 3:302832547..302832715(-)
• Located in intron of: ENSMODG00000012332

Retrocopy information

• Ensembl ID: None
• Aliases: None
• Status: NOVEL

Parental gene information

• Parental gene symbol: SNRPE
• Ensembl ID: ENSMODG00000028394
• Aliases: None
• Description: small nuclear ribonucleoprotein polypeptide E [Source:HGNC Symbol;Acc:11161]

Sequence

>retro_mdom_1164
ATTCAGATGTGGCTTTTTGAGCAAGTAAATATGCAAATGAAAGCCTGCATAATTGGTTTTGAGGAGTATACGAATCTTAT
ATTGGATGATTGGGAGGAGATTTACTCCAAAAAAAAGTCAAGGAAATGACATACTTGGAACATGCTAAAAGAAGACCACA
TTACTATA

Alignment

ORF - retro_mdom_1164 Open Reading Frame is not conserved.

Retrocopy - Parental Gene Alignment summary:

• Percent Identity: 60.71 %
• Parental protein coverage: 60.87 %
• Number of stop codons detected: 1
• Number of frameshifts detected: 0

Retrocopy - Parental Gene Alignment:

Parental  IQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITL
          IQ.WL.EQVNM....CIIGF.EY.NL.LDD.EEI.S...SRK.....MLK.D.IT.
Retrocopy IQMWLFEQVNMQMKACIIGFEEYTNLILDDWEEIYSXXXSRK*HTWNMLKEDHITI

Legend:

• *: Stop codon
• >: Forward frameshift by one nucleotide
• <: Reverse frameshift by one nucleotide

Expression

RNA-Seq

Expression validation based on RNA-Seq data:

Library	Retrocopy expression	Parental gene expression
SRP007412_brain	0.00 RPM	0.00 RPM
SRP007412_cerebellum	0.00 RPM	0.00 RPM
SRP007412_heart	0.00 RPM	0.00 RPM
SRP007412_kidney	0.00 RPM	0.00 RPM
SRP007412_liver	0.00 RPM	0.00 RPM
SRP007412_testis	0.00 RPM	0.00 RPM

ChIP-Seq

Monodelphis domestica was not studied using ChIP-Seq data.

EST

No EST(s) were mapped for retro_mdom_1164 retrocopy.

TSS

Monodelphis domestica was not studied using FANTOM5 data.

Lab

retro_mdom_1164 was not experimentally validated.

Homology

Retrocopy orthology:

Monodelphis domestica does not belong to any of the species groups (eutheria, teleost or neognath), studied for retrocopy-based homology. For more information about studied groups, please go to help section.

---

Parental genes homology:

Parental genes homology involve 16 parental genes, and 141 retrocopies.

Species	Parental gene accession	Retrocopies number
Ailuropoda melanoleuca	ENSAMEG00000000882	8 retrocopies	retro_amel_1112, retro_amel_1206, retro_amel_1211, retro_amel_1293, retro_amel_1517, retro_amel_1530, retro_amel_185, retro_amel_412,
Choloepus hoffmanni	ENSCHOG00000009158	6 retrocopies	retro_chof_139, retro_chof_1870, retro_chof_1897, retro_chof_1981, retro_chof_2652, retro_chof_450,
Callithrix jacchus	ENSCJAG00000006735	1 retrocopy	retro_cjac_3163,
Dasypus novemcinctus	ENSDNOG00000004490	24 retrocopies	retro_dnov_1009, retro_dnov_1141, retro_dnov_122, retro_dnov_1223, retro_dnov_1312, retro_dnov_1314, retro_dnov_1362, retro_dnov_1438, retro_dnov_163, retro_dnov_191, retro_dnov_2398, retro_dnov_2671, retro_dnov_360, retro_dnov_414, retro_dnov_513, retro_dnov_579, retro_dnov_796, retro_dnov_828, retro_dnov_898, retro_dnov_900, retro_dnov_902, retro_dnov_93, retro_dnov_967, retro_dnov_983,
Echinops telfairi	ENSETEG00000014015	24 retrocopies	retro_etel_1136, retro_etel_1244, retro_etel_138, retro_etel_1443, retro_etel_1530, retro_etel_1636, retro_etel_1739, retro_etel_1781, retro_etel_1947, retro_etel_2143, retro_etel_234, retro_etel_258, retro_etel_310, retro_etel_377, retro_etel_466, retro_etel_546, retro_etel_56, retro_etel_579, retro_etel_581, retro_etel_582, retro_etel_76, retro_etel_776, retro_etel_799, retro_etel_80,
Felis catus	ENSFCAG00000000873	2 retrocopies	retro_fcat_1836, retro_fcat_554,
Homo sapiens	ENSG00000182004	10 retrocopies	retro_hsap_130, retro_hsap_1668, retro_hsap_2022, retro_hsap_2073, retro_hsap_2287, retro_hsap_3262, retro_hsap_4228, retro_hsap_4660, retro_hsap_516, retro_hsap_576,
Gorilla gorilla	ENSGGOG00000000755	7 retrocopies	retro_ggor_1462, retro_ggor_1626, retro_ggor_1700, retro_ggor_2221, retro_ggor_228, retro_ggor_2892, retro_ggor_91,
Microcebus murinus	ENSMICG00000015537	3 retrocopies	retro_mmur_1406, retro_mmur_453, retro_mmur_58,
Myotis lucifugus	ENSMLUG00000013244	8 retrocopies	retro_mluc_1639, retro_mluc_1650, retro_mluc_1994, retro_mluc_2045, retro_mluc_2088, retro_mluc_2326, retro_mluc_85, retro_mluc_919,
Monodelphis domestica	ENSMODG00000028394	3 retrocopies	retro_mdom_1164 , retro_mdom_1790, retro_mdom_1865,
Mustela putorius furo	ENSMPUG00000011642	7 retrocopies	retro_mputfur_1078, retro_mputfur_1527, retro_mputfur_1634, retro_mputfur_53, retro_mputfur_638, retro_mputfur_729, retro_mputfur_949,
Mus musculus	ENSMUSG00000090553	10 retrocopies	retro_mmus_1527, retro_mmus_1597, retro_mmus_1704, retro_mmus_2090, retro_mmus_2788, retro_mmus_2953, retro_mmus_296, retro_mmus_3001, retro_mmus_3682, retro_mmus_898,
Pongo abelii	ENSPPYG00000000326	8 retrocopies	retro_pabe_1375, retro_pabe_20, retro_pabe_2023, retro_pabe_228, retro_pabe_3015, retro_pabe_3620, retro_pabe_56, retro_pabe_610,
Pan troglodytes	ENSPTRG00000030224	11 retrocopies	retro_ptro_1131, retro_ptro_134, retro_ptro_1345, retro_ptro_1346, retro_ptro_1526, retro_ptro_1620, retro_ptro_2206, retro_ptro_2872, retro_ptro_3096, retro_ptro_385, retro_ptro_426,
Sorex araneus	ENSSARG00000003311	9 retrocopies	retro_sara_171, retro_sara_173, retro_sara_183, retro_sara_214, retro_sara_219, retro_sara_37, retro_sara_664, retro_sara_697, retro_sara_750,