RetrogeneDB ID: | retro_shar_295 | ||
Retrocopylocation | Organism: | Tasmanian devil (Sarcophilus harrisii) | |
Coordinates: | GL841248.1:793921..794134(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPL37 | ||
Ensembl ID: | ENSSHAG00000013969 | ||
Aliases: | None | ||
Description: | ribosomal protein L37 [Source:HGNC Symbol;Acc:10347] |
Percent Identity: | 54.79 % |
Parental protein coverage: | 73.2 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | YHLQKSTCGKCGYPAKRKR-KYNWSAKAKRRNT-TGTGRMRHLKIVYRRFRNGFREGTTPKPKRAAVAAS |
YHLQKST.GK..Y....KR.K.N..AKAKR.....G.G..RHLKIV...FRNG..EG..PK....A...S | |
Retrocopy | YHLQKST*GKFVYKVRHKR>KNNYIAKAKRYSI<IGSG*IRHLKIVSSQFRNGLHEGAKPKTQEVAIRKS |
Parental | SSS |
SSS | |
Retrocopy | SSS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000005142 | 6 retrocopies | |
Callithrix jacchus | ENSCJAG00000007388 | 10 retrocopies | |
Latimeria chalumnae | ENSLACG00000002787 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000030052 | 13 retrocopies | |
Macaca mulatta | ENSMMUG00000023807 | 6 retrocopies | |
Monodelphis domestica | ENSMODG00000020301 | 3 retrocopies | |
Nomascus leucogenys | ENSNLEG00000016508 | 4 retrocopies | |
Otolemur garnettii | ENSOGAG00000034300 | 7 retrocopies | |
Rattus norvegicus | ENSRNOG00000012538 | 6 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000013969 | 4 retrocopies |