RetrogeneDB ID: | retro_btau_1430 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
Coordinates: | 5:66108867..66109095(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPL37 | ||
Ensembl ID: | ENSBTAG00000005142 | ||
Aliases: | None | ||
Description: | 60S ribosomal protein L37 [Source:UniProtKB/Swiss-Prot;Acc:P79244] |
Percent Identity: | 82.89 % |
Parental protein coverage: | 78.35 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | CGSKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTGTGRMRHLKIVYRRFRHGFREGTTPKPKRAAV |
CGSKAYHLQK.T.GKCGYP.KRKRKYNWSAKAKR.NTTG.GRMRHLKI.Y.RFRHGF.E..TPKPK..AV | |
Retrocopy | CGSKAYHLQK*THGKCGYPTKRKRKYNWSAKAKRQNTTGAGRMRHLKILYLRFRHGFHERATPKPKQVAV |
Parental | AASSSS |
A.SSSS | |
Retrocopy | ATSSSS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
ERP005899_liver | 0 .00 RPM | 74 .98 RPM |
ERP005899_muscle | 0 .05 RPM | 610 .98 RPM |
SRP017611_brain | 0 .00 RPM | 61 .35 RPM |
SRP017611_kidney | 0 .00 RPM | 98 .21 RPM |
SRP017611_liver | 0 .00 RPM | 73 .62 RPM |
SRP030211_testis | 0 .03 RPM | 64 .89 RPM |