RetrogeneDB ID: | retro_mdom_1843 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 8:68567168..68567364(+) | ||
Located in intron of: | ENSMODG00000009503 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSMODG00000020301 | ||
Aliases: | None | ||
Description: | Ribosomal protein L37 [Source:UniProtKB/TrEMBL;Acc:F7BFG9] |
Percent Identity: | 51.47 % |
Parental protein coverage: | 67.01 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 3 |
Parental | SKAYHL-QKSTCG-KCGYPAKRKRKYNWSAKAKRRNTTGTGRMRHLK-IVYRRFRNGFREGTTPKPKR |
SKA.HL..K.T.G.KC..P.K.K.K.N.SAKAKR.N..G....RH.K.IV...F.NGF.E....KP.. | |
Retrocopy | SKAEHL>EKTTLG>KCEHPTKDKIKCN*SAKAKRYNSIGSDERRHQK<IVHH*F*NGFCEEAASKPRK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |