RetrogeneDB ID: | retro_dnov_1517 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_22468:47371..47593(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SSBP1 | ||
| Ensembl ID: | ENSDNOG00000015867 | ||
| Aliases: | None | ||
| Description: | single-stranded DNA binding protein 1, mitochondrial [Source:HGNC Symbol;Acc:11317] |
| Percent Identity: | 65.38 % |
| Parental protein coverage: | 50.68 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 3 |
| Parental | QMGDVSQKTTWHRI-SVFRPGLRDVAYQYVKKG-SRIYVEGKVDYGEYTDKNNVRRQATTIIVD-NIIFL |
| ..GD.SQ..TW.RI..VF.PGLRDVAY..VKK..S.IY.EGKVD..E...KNN.R.Q.TTIIV...IIFL | |
| Retrocopy | RIGDISQMKTWQRI<TVFQPGLRDVAYLCVKKS<S*IYMEGKVDNSE*MEKNNERGQETTIIVE<TIIFL |
| Parental | SDQIKEKA |
| SDQ.KEKA | |
| Retrocopy | SDQTKEKA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 18 .47 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 9 .90 RPM |
| SRP012922_heart | 0 .00 RPM | 6 .96 RPM |
| SRP012922_kidney | 0 .00 RPM | 16 .98 RPM |
| SRP012922_liver | 0 .00 RPM | 11 .30 RPM |
| SRP012922_lung | 0 .00 RPM | 17 .72 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 5 .02 RPM |
| SRP012922_spleen | 0 .00 RPM | 18 .89 RPM |