RetrogeneDB ID: | retro_mmus_2805 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
Coordinates: | 6:16728864..16729097(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Rps17 | ||
Ensembl ID: | ENSMUSG00000061787 | ||
Aliases: | None | ||
Description: | ribosomal protein S17 [Source:MGI Symbol;Acc:MGI:1309526] |
Percent Identity: | 61.25 % |
Parental protein coverage: | 58.52 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | LMKRIQRGPVRGISIKLQEEER-ERRDNYVPEVSALDQEIIEVDPDTKEMLKLLDFGSLSNLQVTQPTVG |
.MKRI.RGPV..IS..L..E....RRDNYVPEVS.LDQ......P.TKEMLK..D..SLSNLQV.Q..V. | |
Retrocopy | MMKRIKRGPVSSISTILHGERK<KRRDNYVPEVSILDQ-LTKTGPNTKEMLKFVDSVSLSNLQVLQTAVR |
Parental | MNFKTPRGAV |
MNFKTP.G.. | |
Retrocopy | MNFKTPSGTL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 44 .76 RPM |
SRP007412_cerebellum | 0 .00 RPM | 37 .91 RPM |
SRP007412_heart | 0 .00 RPM | 90 .78 RPM |
SRP007412_kidney | 0 .00 RPM | 88 .05 RPM |
SRP007412_liver | 0 .00 RPM | 73 .27 RPM |
SRP007412_testis | 0 .00 RPM | 57 .40 RPM |