RetrogeneDB ID: | retro_mmus_2805 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 6:16728864..16729097(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Rps17 | ||
| Ensembl ID: | ENSMUSG00000061787 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S17 [Source:MGI Symbol;Acc:MGI:1309526] |
| Percent Identity: | 61.25 % |
| Parental protein coverage: | 58.52 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | LMKRIQRGPVRGISIKLQEEER-ERRDNYVPEVSALDQEIIEVDPDTKEMLKLLDFGSLSNLQVTQPTVG |
| .MKRI.RGPV..IS..L..E....RRDNYVPEVS.LDQ......P.TKEMLK..D..SLSNLQV.Q..V. | |
| Retrocopy | MMKRIKRGPVSSISTILHGERK<KRRDNYVPEVSILDQ-LTKTGPNTKEMLKFVDSVSLSNLQVLQTAVR |
| Parental | MNFKTPRGAV |
| MNFKTP.G.. | |
| Retrocopy | MNFKTPSGTL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 44 .76 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 37 .91 RPM |
| SRP007412_heart | 0 .00 RPM | 90 .78 RPM |
| SRP007412_kidney | 0 .00 RPM | 88 .05 RPM |
| SRP007412_liver | 0 .00 RPM | 73 .27 RPM |
| SRP007412_testis | 0 .00 RPM | 57 .40 RPM |