RetrogeneDB ID: | retro_cfam_307 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 1:43442810..43443035(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS17 | ||
| Ensembl ID: | ENSCAFG00000013053 | ||
| Aliases: | None | ||
| Description: | Canis lupus familiaris ribosomal protein S17 (RPS17), mRNA. [Source:RefSeq mRNA;Acc:NM_001003099] |
| Percent Identity: | 64.94 % |
| Parental protein coverage: | 55.97 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | IQRGPVRGISIKLQEEERERRDNYVPEVSALDQEIIE-VDPDTKEMLKLLDFG-SLSNLQVTQPTVGMNF |
| I.RG.VR....KLQ.E.RE.R.N.VPEVS.LDQEI.E..D.DTKEMLK.L.FG..LS.LQV.QPTV..NF | |
| Retrocopy | IHRGRVRETPSKLQMELREERSNCVPEVSVLDQEIFE>IDRDTKEMLKVLNFG<HLSSLQVSQPTVEVNF |
| Parental | KTPRGAV |
| K.P.GA. | |
| Retrocopy | KIPVGAI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 232 .34 RPM |
| SRP017611_brain | 0 .00 RPM | 76 .61 RPM |
| SRP017611_kidney | 0 .00 RPM | 629 .86 RPM |
| SRP017611_liver | 0 .00 RPM | 150 .39 RPM |