RetrogeneDB ID: | retro_sscr_464 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
Coordinates: | 15:86475652..86475892(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FAU | ||
Ensembl ID: | ENSSSCG00000013002 | ||
Aliases: | None | ||
Description: | Sus scrofa Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed (FAU), mRNA. [Source:RefSeq mRNA;Acc:NM_213937] |
Percent Identity: | 70.37 % |
Parental protein coverage: | 60.9 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | KAHVASLEGIAPEDQVLLLAGTPLEDDAILGQCGVEALSTLEVAGRMLGGKVHGSLARAGKVRGQTPKVA |
......LEGI.P.DQ.LLLAG.P..D...LGQC..EALSTL.VAGRMLGGKV.GSLA.AG.VRGQTP..A | |
Retrocopy | RSRLMLLEGISPKDQALLLAGMPPKDEPNLGQCR-EALSTLKVAGRMLGGKVCGSLACAGQVRGQTPTGA |
Parental | KQEKKKKKTGR |
KQ.KKKKKTGR | |
Retrocopy | KQDKKKKKTGR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP014902_placenta | 0 .00 RPM | 476 .90 RPM |
SRP014902_testis | 0 .00 RPM | 613 .74 RPM |
SRP018288_heart | 0 .00 RPM | 159 .23 RPM |
SRP018288_kidney | 0 .00 RPM | 283 .20 RPM |
SRP018288_liver | 0 .00 RPM | 335 .81 RPM |
SRP018288_lung | 0 .00 RPM | 288 .68 RPM |
SRP018856_adipose | 0 .00 RPM | 492 .19 RPM |
SRP035408_brain | 0 .00 RPM | 333 .90 RPM |
SRP035408_liver | 0 .03 RPM | 355 .85 RPM |