RetrogeneDB ID: | retro_dnov_2075 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_45953:5969..6200(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSDNOG00000014224 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 70.37 % |
| Parental protein coverage: | 68.42 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 3 |
| Parental | SELACIYSALI-LHDDEVT-VTEDKINALIKAAGVN-VEPFWPGLFAKALANISIGSLICNVGAGGPAPA |
| SELA.I.SAL..LH.DEVT..TEDKI.ALIK.AGV..VEPFWPGLFAKALA....GSL.C.VG.GGP.PA | |
| Retrocopy | SELAGIDSALN<LHEDEVT<ITEDKIDALIKVAGVR<VEPFWPGLFAKALAHVHTGSLACYVGVGGPTPA |
| Parental | AGAAPAGGPAP |
| .GAAP....AP | |
| Retrocopy | VGAAPSTTAAP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 855 .66 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 408 .28 RPM |
| SRP012922_heart | 0 .46 RPM | 468 .47 RPM |
| SRP012922_kidney | 0 .00 RPM | 1049 .46 RPM |
| SRP012922_liver | 0 .00 RPM | 483 .62 RPM |
| SRP012922_lung | 0 .00 RPM | 1291 .44 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 1577 .15 RPM |
| SRP012922_spleen | 0 .00 RPM | 1258 .96 RPM |