RetrogeneDB ID: | retro_opri_972 | ||
Retrocopylocation | Organism: | Southern American pika (Ochotona princeps) | |
Coordinates: | scaffold_5144:140710..140936(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPLP1 | ||
Ensembl ID: | ENSOPRG00000001163 | ||
Aliases: | None | ||
Description: | ribosomal protein, large, P1 [Source:HGNC Symbol;Acc:10372] |
Percent Identity: | 56.58 % |
Parental protein coverage: | 65.79 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | EDKINALIKAAGVNVEPFWPGLFAKALANVNIGSLICNVGAGGPAPAAGAAP-AGGPAPAAAAAPAEEKK |
..K..ALIKAA.VNVE.....LFA..LA.VN.GSL.C.V.AG.PAP.A.AAP....P.P..A.AP..EK. | |
Retrocopy | QNKTKALIKAACVNVEELRCYLFADELASVNSGSLLCIVRAGRPAPEAAAAP>KQWP*PSTATAPVQEKE |
Parental | VEAKKE |
VE.KK. | |
Retrocopy | VETKKD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |