RetrogeneDB ID: | retro_ggor_1676 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 2a:39760606..39760900(-) | ||
Located in intron of: | ENSGGOG00000026950 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | HSPE1 | ||
Ensembl ID: | ENSGGOG00000027944 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 64.76 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 3 |
Parental | MAGQAFRKFLPLFDRVLV-ERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSK-GKGGEIQ-PVSVKV |
....AFR.FLPL.D.VL..ER...ETVTKG..MLPEKSQGKVL.ATV..VGS.SK..KG.....PV...V | |
Retrocopy | LSAHAFRRFLPLYDHVLM<ERNMPETVTKGD-MLPEKSQGKVL*ATV-DVGSDSK<SKGWRVN<PVNM*V |
Parental | GDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD |
GD.VL.PEY.GTKVVLD.KDYF.F.DGDIL..Y.D | |
Retrocopy | GDRVL-PEYVGTKVVLDSKDYFSFKDGDILANYMD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 66 .03 RPM |
SRP007412_cerebellum | 0 .00 RPM | 33 .29 RPM |
SRP007412_heart | 0 .00 RPM | 38 .15 RPM |
SRP007412_kidney | 0 .08 RPM | 204 .49 RPM |
SRP007412_liver | 0 .00 RPM | 113 .82 RPM |
SRP007412_testis | 0 .00 RPM | 58 .53 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000007417 | 17 retrocopies | |
Callithrix jacchus | ENSCJAG00000004008 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000013246 | 27 retrocopies |
retro_dnov_1088, retro_dnov_1117, retro_dnov_1214, retro_dnov_1375, retro_dnov_1391, retro_dnov_1405, retro_dnov_1412, retro_dnov_1428, retro_dnov_1445, retro_dnov_1546, retro_dnov_1647, retro_dnov_1652, retro_dnov_1686, retro_dnov_1821, retro_dnov_2176, retro_dnov_2291, retro_dnov_2413, retro_dnov_2569, retro_dnov_2625, retro_dnov_2652, retro_dnov_418, retro_dnov_481, retro_dnov_483, retro_dnov_490, retro_dnov_524, retro_dnov_554, retro_dnov_966,
|
Erinaceus europaeus | ENSEEUG00000005040 | 6 retrocopies | |
Gorilla gorilla | ENSGGOG00000027944 | 17 retrocopies | |
Mus musculus | ENSMUSG00000073676 | 11 retrocopies | |
Procavia capensis | ENSPCAG00000009541 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000016078 | 7 retrocopies |