RetrogeneDB ID: | retro_chof_303 | ||
Retrocopy location | Organism: | Sloth (Choloepus hoffmanni) | |
| Coordinates: | GeneScaffold_6968:92651..92855(-) | ||
| Located in intron of: | ENSCHOG00000001029 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | HSPE1 | ||
| Ensembl ID: | ENSCHOG00000007417 | ||
| Aliases: | None | ||
| Description: | heat shock 10kDa protein 1 (chaperonin 10) [Source:HGNC Symbol;Acc:5269] |
| Percent Identity: | 70.59 % |
| Parental protein coverage: | 66.67 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | EKSQGKVLQATVLAVGSGAKGKGGQIEPVSVKVGDKVLLPEYGGTKVVLEEKEYFLFRDSDILGKYIE |
| .K.....LQATV.AVG...KG.GG..EPVS..VGDKVLLPEYGGTKVVL..K.YFLFRD.DILGKY.E | |
| Retrocopy | QKNLKEILQATVVAVGLITKGEGGHMEPVSMNVGDKVLLPEYGGTKVVLDDKDYFLFRDADILGKYVE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |