RetrogeneDB ID: | retro_mmus_1750 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 18:9335194..9335413(-) | ||
| Located in intron of: | ENSMUSG00000024286 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Hspe1 | ||
| Ensembl ID: | ENSMUSG00000073676 | ||
| Aliases: | Hspe1, 10kDa, Hsp10, mt-cpn10 | ||
| Description: | heat shock protein 1 (chaperonin 10) [Source:MGI Symbol;Acc:MGI:104680] |
| Percent Identity: | 86.49 % |
| Parental protein coverage: | 72.55 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | GGIMLPEKSQGKVLQATVVAVGSGGKGKSGEIEPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDSDILG |
| G.IMLPEKSQGKV.QA.VVAVGSGGKGK.GEI.PVSVKV..K.LLPEY.GTKVVLDDKDY.LFRDSDILG | |
| Retrocopy | GAIMLPEKSQGKVFQAMVVAVGSGGKGKGGEIQPVSVKVREK-LLPEYRGTKVVLDDKDYALFRDSDILG |
| Parental | KYVD |
| KYVD | |
| Retrocopy | KYVD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .12 RPM | 19 .06 RPM |
| SRP007412_cerebellum | 0 .09 RPM | 18 .80 RPM |
| SRP007412_heart | 0 .03 RPM | 39 .32 RPM |
| SRP007412_kidney | 0 .06 RPM | 64 .04 RPM |
| SRP007412_liver | 0 .03 RPM | 64 .07 RPM |
| SRP007412_testis | 0 .00 RPM | 5 .95 RPM |
| Experiment type: | PCR amplification |
|---|---|
| Forward primer: | TAGTGTTGTGACATGTGTTCT (21 nt long) |
| Reverse primer: | GACACCATTTCAACAGTGATT (21 nt long) |
| Annealing temperature: | 50 °C |
| (Expected) product size: | 398 |
| Electrophoresis gel image: | ![]() |
| Additional comment: | Pfu DNA Polymerase; pooled mouse cDNA; 40 cycles of PCR |