RetrogeneDB ID: | retro_eeur_474 | ||
Retrocopy location | Organism: | Hedgehog (Erinaceus europaeus) | |
| Coordinates: | scaffold_319269:6470..6659(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | HSPE1 | ||
| Ensembl ID: | ENSEEUG00000005040 | ||
| Aliases: | None | ||
| Description: | heat shock 10kDa protein 1 (chaperonin 10) [Source:HGNC Symbol;Acc:5269] |
| Percent Identity: | 60.32 % |
| Parental protein coverage: | 63.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | RVLLTAVAAXXXXXXXXTGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD |
| .VL...V.A.........GEIQPVSVK..DKVL..E..G.KVVLDD..YFL.RDGDILGK.VD | |
| Retrocopy | KVLQAIVIALGYGSKGKFGEIQPVSVKIKDKVLMAENRGNKVVLDDRVYFLYRDGDILGK*VD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 13 .21 RPM |
| SRP017611_kidney | 0 .00 RPM | 58 .32 RPM |
| SRP017611_liver | 0 .00 RPM | 43 .09 RPM |