RetrogeneDB ID: | retro_sscr_1159 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
Coordinates: | X:62672480..62672633(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SNRPE | ||
Ensembl ID: | ENSSSCG00000023562 | ||
Aliases: | SNRPE, Sm-E, SmE, snRNP-E | ||
Description: | small nuclear ribonucleoprotein polypeptide E [Source:HGNC Symbol;Acc:11161] |
Percent Identity: | 82.35 % |
Parental protein coverage: | 55.43 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | GQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMN |
GQGQKV.KVMVQPIN.IFRYLQNR..IQVWLYEQVNM..E.CII.F.EYMN | |
Retrocopy | GQGQKVWKVMVQPINVIFRYLQNRFWIQVWLYEQVNMWTEDCIIDFSEYMN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP014902_placenta | 0 .00 RPM | 11 .41 RPM |
SRP014902_testis | 0 .00 RPM | 46 .96 RPM |
SRP018288_heart | 0 .00 RPM | 33 .13 RPM |
SRP018288_kidney | 0 .00 RPM | 33 .39 RPM |
SRP018288_liver | 0 .00 RPM | 32 .14 RPM |
SRP018288_lung | 0 .00 RPM | 11 .71 RPM |
SRP018856_adipose | 0 .00 RPM | 18 .56 RPM |
SRP035408_brain | 0 .00 RPM | 30 .33 RPM |
SRP035408_liver | 0 .00 RPM | 36 .61 RPM |