RetrogeneDB ID: | retro_sscr_274 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 11:3479213..3479505(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FUNDC2 | ||
| Ensembl ID: | ENSSSCG00000012817 | ||
| Aliases: | None | ||
| Description: | Sus scrofa FUN14 domain containing 2 (FUNDC2), mRNA. [Source:RefSeq mRNA;Acc:NM_213743] |
| Percent Identity: | 72.28 % |
| Parental protein coverage: | 51.85 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 3 |
| Parental | VTGWCTGFIF-QKVGKLAATAVGGG-FFLLQLAN-HTGYIKVDWQRVEKDMKKAKEQLKIRKSNQIPTEV |
| VTG.CTGFIF.Q.VG.L.ATA..GG.FFLL.LAN.H.GY..VD.Q.V.KD.K.A.EQLK....NQIPTE. | |
| Retrocopy | VTGGCTGFIF>QQVGELTATAGRGG>FFLLPLAN<HSGYLSVDRQQV-KDRKQAREQLKMGERNQIPTED |
| Parental | KSKAEEVVSFVKKNVLVTGGFFGGFLLGMAS |
| KSKAEEVVS.VKKNVLVTGGFF.GF.LGM.S | |
| Retrocopy | KSKAEEVVSLVKKNVLVTGGFFRGFPLGMTS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 34 .64 RPM |
| SRP014902_testis | 0 .57 RPM | 27 .72 RPM |
| SRP018288_heart | 0 .03 RPM | 41 .57 RPM |
| SRP018288_kidney | 0 .10 RPM | 45 .90 RPM |
| SRP018288_liver | 0 .00 RPM | 19 .03 RPM |
| SRP018288_lung | 0 .00 RPM | 28 .61 RPM |
| SRP018856_adipose | 0 .00 RPM | 82 .94 RPM |
| SRP035408_brain | 0 .06 RPM | 55 .04 RPM |
| SRP035408_liver | 0 .00 RPM | 44 .18 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000016977 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000004306 | 11 retrocopies | |
| Callithrix jacchus | ENSCJAG00000004287 | 3 retrocopies | |
| Dipodomys ordii | ENSDORG00000013156 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000013817 | 2 retrocopies | |
| Homo sapiens | ENSG00000165775 | 3 retrocopies | |
| Loxodonta africana | ENSLAFG00000015289 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000007776 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000010248 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000016484 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000031198 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000014443 | 5 retrocopies | |
| Otolemur garnettii | ENSOGAG00000033461 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000020897 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000041852 | 4 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000013552 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000024066 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000012817 | 1 retrocopy |
retro_sscr_274 ,
|
| Ictidomys tridecemlineatus | ENSSTOG00000007801 | 2 retrocopies |