RetrogeneDB ID: | retro_mmus_3321 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
Coordinates: | 9:22330266..22330488(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Rps20 | ||
Ensembl ID: | ENSMUSG00000028234 | ||
Aliases: | None | ||
Description: | ribosomal protein S20 [Source:MGI Symbol;Acc:MGI:1914677] |
Percent Identity: | 83.12 % |
Parental protein coverage: | 64.71 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | EPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKTPCGEGSKTWDRFQ |
...VAIH.IRITLTSR...SLEKV..DLIRGA.EKNLKVKGPV..PTKTLRIT.RKTPCGEGSKTWDRFQ | |
Retrocopy | DTQVAIHQIRITLTSR---SLEKVGTDLIRGAEEKNLKVKGPVCTPTKTLRITARKTPCGEGSKTWDRFQ |
Parental | MRIHKRL |
MRIHKRL | |
Retrocopy | MRIHKRL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .05 RPM | 46 .61 RPM |
SRP007412_cerebellum | 0 .04 RPM | 22 .67 RPM |
SRP007412_heart | 0 .00 RPM | 59 .96 RPM |
SRP007412_kidney | 0 .02 RPM | 59 .75 RPM |
SRP007412_liver | 0 .03 RPM | 64 .78 RPM |
SRP007412_testis | 0 .69 RPM | 106 .98 RPM |
ENCODE library ID | Target | ChIP-Seq Peak coordinates |
---|---|---|
ENCFF001YKA | POLR2A | 9:22329158..22330644 |
ENCFF001YKA | POLR2A | 9:22330881..22340680 |