RetrogeneDB ID: | retro_fcat_1079 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | C1:19778076..19778286(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS20 | ||
| Ensembl ID: | ENSFCAG00000029233 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S20 [Source:HGNC Symbol;Acc:10405] |
| Percent Identity: | 82.86 % |
| Parental protein coverage: | 58.82 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MAFKDTGKTPVEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKTPC |
| MAFKDTGKTP.EPEVAI.R.R.TLTS...KSLEKV.ADLI.GAKEK.L.VKGPV.MPTKTLRITTRKTPC | |
| Retrocopy | MAFKDTGKTPLEPEVAIRRVRMTLTSHSIKSLEKVFADLITGAKEKTLNVKGPVWMPTKTLRITTRKTPC |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 55 .09 RPM |
| SRP017611_kidney | 0 .00 RPM | 171 .18 RPM |
| SRP017611_liver | 0 .00 RPM | 76 .53 RPM |