RetrogeneDB ID: | retro_pabe_2708 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 5:180039522..180039759(+) | ||
| Located in intron of: | ENSPPYG00000016087 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS20 | ||
| Ensembl ID: | ENSPPYG00000018600 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S20 [Source:HGNC Symbol;Acc:10405] |
| Percent Identity: | 74.07 % |
| Parental protein coverage: | 68.07 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | FKDTGKTPVEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKTPCGE |
| FKDTG...VEPEV.IH.I.ITL.S.NVKS.EKVC.DLIR.AKEKNLKVKGP..MPTK..RI.TRKTPC.E | |
| Retrocopy | FKDTGRKSVEPEVTIH*I*ITLMSCNVKSPEKVCPDLIREAKEKNLKVKGPAGMPTKASRI-TRKTPC-E |
| Parental | GSKTWDRFQMR |
| G..T.D.FQMR | |
| Retrocopy | GPNTRDHFQMR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 91 .06 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 60 .68 RPM |
| SRP007412_heart | 0 .00 RPM | 97 .78 RPM |
| SRP007412_kidney | 0 .00 RPM | 173 .72 RPM |
| SRP007412_liver | 0 .03 RPM | 152 .92 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3272 |
| Pan troglodytes | retro_ptro_2213 |
| Gorilla gorilla | retro_ggor_2227 |