RetrogeneDB ID: | retro_dnov_1822 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_32078:113..341(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SUB1 | ||
Ensembl ID: | ENSDNOG00000007611 | ||
Aliases: | None | ||
Description: | SUB1 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:19985] |
Percent Identity: | 97.37 % |
Parental protein coverage: | 59.84 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MPKSKELVSSSSSGSDSDSEVDKKLKRKKQIPPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMR |
MPKSKELVSSSSSGSDSDSEV.KKLKR.KQIPPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMR | |
Retrocopy | MPKSKELVSSSSSGSDSDSEVYKKLKREKQIPPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMR |
Parental | YVSVRD |
YVSVRD | |
Retrocopy | YVSVRD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 18 .47 RPM | 82 .65 RPM |
SRP012922_cerebellum | 13 .06 RPM | 62 .82 RPM |
SRP012922_heart | 9 .98 RPM | 75 .18 RPM |
SRP012922_kidney | 18 .62 RPM | 115 .27 RPM |
SRP012922_liver | 11 .92 RPM | 51 .24 RPM |
SRP012922_lung | 16 .65 RPM | 114 .70 RPM |
SRP012922_quadricep_muscle | 10 .04 RPM | 49 .85 RPM |
SRP012922_spleen | 41 .89 RPM | 203 .97 RPM |