RetrogeneDB ID: | retro_cjac_506 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 1:15841149..15841568(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCJAG00000003810 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 79.43 % |
| Parental protein coverage: | 68.63 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MGAYKYIQELWRKKQSDVMRFLL-RVRCWQYRQLSALHRAPRPTRPDKARRLGYKAKQGYVIYRIRVRRG |
| MG.YKY.QEL.RKKQSDVMRFLL.RV.C.Q.RQLS.LHRAP.PTRPDKA.RL.YK..QGY.IY.I.V..G | |
| Retrocopy | MGGYKYTQEL*RKKQSDVMRFLL<RVCCRQCRQLSVLHRAPHPTRPDKACRLCYKTQQGYIIYIICVHHG |
| Parental | GRKRPVPKGATYGKPVHHGVNQLKFARSLQSVAEERAGRHCGALRVLNSYWVGEDSTYKFFEVILIDPFH |
| G.K..VPKG.TY.KPVHHGV.QLKFA..LQ.VAEERAG.H.GALRVLNSYWVGEDSTYKFFEVILIDPFH | |
| Retrocopy | GQKCRVPKGGTYRKPVHHGVKQLKFAQNLQFVAEERAGCHPGALRVLNSYWVGEDSTYKFFEVILIDPFH |
| Parental | K |
| K | |
| Retrocopy | K |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 57 .58 RPM |
| SRP051959_heart | 0 .00 RPM | 53 .55 RPM |
| SRP051959_kidney | 0 .00 RPM | 53 .38 RPM |
| SRP051959_liver | 0 .00 RPM | 76 .16 RPM |
| SRP051959_lung | 0 .00 RPM | 50 .87 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 60 .41 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 53 .94 RPM |
| SRP051959_spleen | 0 .00 RPM | 60 .46 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000003497 | 6 retrocopies | |
| Callithrix jacchus | ENSCJAG00000003810 | 23 retrocopies |
retro_cjac_1052, retro_cjac_1270, retro_cjac_1316, retro_cjac_1553, retro_cjac_1578, retro_cjac_1625, retro_cjac_1668, retro_cjac_1741, retro_cjac_2143, retro_cjac_2330, retro_cjac_2518, retro_cjac_2532, retro_cjac_2599, retro_cjac_2821, retro_cjac_2907, retro_cjac_3807, retro_cjac_4185, retro_cjac_506 , retro_cjac_585, retro_cjac_712, retro_cjac_734, retro_cjac_783, retro_cjac_890,
|
| Equus caballus | ENSECAG00000010157 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000004155 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000011995 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000014065 | 18 retrocopies | |
| Pan troglodytes | ENSPTRG00000014695 | 14 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000001771 | 13 retrocopies | |
| Tursiops truncatus | ENSTTRG00000007244 | 5 retrocopies | |
| Vicugna pacos | ENSVPAG00000008573 | 2 retrocopies |