RetrogeneDB ID: | retro_mputfur_1575 | ||
Retrocopy location | Organism: | Ferret (Mustela putorius furo) | |
| Coordinates: | GL897271.1:489172..489415(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ATP5G1 | ||
| Ensembl ID: | ENSMPUG00000015341 | ||
| Aliases: | None | ||
| Description: | ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C1 (subunit 9) [Source:HGNC Symbol;Acc:841] |
| Percent Identity: | 51.81 % |
| Parental protein coverage: | 59.85 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 0 |
| Parental | MQTTGALLISPALIRCCTRDLIRPVSASL-LSRPDIPAKQPSYSSNSPLQVARREFQTSVVSRDIDTAAK |
| M.TT.ALLI..ALI.CC...........L.L..P.IP.KQPS.S..SP..V..REFQTS..S.D.D..AK | |
| Retrocopy | M*TTKALLIYLALIHCCSWPMSNQACVCLFLHKPWIPPKQPS*SI-SPH*VVQREFQTSLFSQDKDIEAK |
| Parental | FIGAGAATVGVAG |
| ...A.A.TV.VAG | |
| Retrocopy | LLAAAATTV-VAG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |