RetrogeneDB ID: | retro_cjac_1549 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 17:37710366..37710600(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ATP5G1 | ||
Ensembl ID: | ENSCJAG00000007352 | ||
Aliases: | None | ||
Description: | ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C1 (subunit 9) [Source:HGNC Symbol;Acc:841] |
Percent Identity: | 66.67 % |
Parental protein coverage: | 57.35 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MQTTGALLISPALIRCCTRGLIRPVSASFLNSPENSSKQPSSSSSPLQVARREFQTSVVSRDIDTAAKFI |
MQT.GALLIS..LI.C..RGL.R.VSASFLN.P.N.S.QPS.SS.PL.V.R.EFQT.V.S.D.DTAAKFI | |
Retrocopy | MQTLGALLISQGLIYCSSRGLLRSVSASFLNRPNNLSEQPSYSSAPLYVTRWEFQTWVAS*DVDTAAKFI |
Parental | GAGAATVG |
..G..T.G | |
Retrocopy | DTGEVTSG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 10 .05 RPM |
SRP051959_heart | 0 .00 RPM | 18 .93 RPM |
SRP051959_kidney | 0 .02 RPM | 11 .94 RPM |
SRP051959_liver | 0 .00 RPM | 11 .74 RPM |
SRP051959_lung | 0 .02 RPM | 4 .07 RPM |
SRP051959_lymph_node | 0 .00 RPM | 3 .79 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 26 .14 RPM |
SRP051959_spleen | 0 .02 RPM | 4 .08 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2844 |
Pan troglodytes | retro_ptro_1926 |
Pongo abelii | retro_pabe_2353 |