RetrogeneDB ID: | retro_ptro_1926 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 3:142409778..142410012(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ATP5G1 | ||
| Ensembl ID: | ENSPTRG00000009364 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 75.64 % |
| Parental protein coverage: | 57.35 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MQTAGALFISPALIRCCTRGLIRPVSASFLNSPVNSSKQPSYSNFPLQVARREFQTSVVSRDIDTAAKFI |
| MQT.GAL.IS.ALI.C.TRGL.R.VSASFLN.P.N.SKQ.SYS..PL.VAR.EFQTSVVS.DIDTAAKFI | |
| Retrocopy | MQTPGALLISQALICCSTRGLLRSVSASFLNRPNNLSKQLSYSSSPLHVAR*EFQTSVVSWDIDTAAKFI |
| Parental | GAGAATVG |
| .AGA.T.G | |
| Retrocopy | DAGAITIG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 59 .86 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 33 .02 RPM |
| SRP007412_heart | 0 .03 RPM | 180 .82 RPM |
| SRP007412_kidney | 0 .05 RPM | 93 .05 RPM |
| SRP007412_liver | 0 .00 RPM | 46 .74 RPM |
| SRP007412_testis | 0 .00 RPM | 14 .33 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2844 |
| Pongo abelii | retro_pabe_2353 |
| Callithrix jacchus | retro_cjac_1549 |