RetrogeneDB ID: | retro_ptro_1926 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 3:142409778..142410012(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ATP5G1 | ||
Ensembl ID: | ENSPTRG00000009364 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 75.64 % |
Parental protein coverage: | 57.35 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MQTAGALFISPALIRCCTRGLIRPVSASFLNSPVNSSKQPSYSNFPLQVARREFQTSVVSRDIDTAAKFI |
MQT.GAL.IS.ALI.C.TRGL.R.VSASFLN.P.N.SKQ.SYS..PL.VAR.EFQTSVVS.DIDTAAKFI | |
Retrocopy | MQTPGALLISQALICCSTRGLLRSVSASFLNRPNNLSKQLSYSSSPLHVAR*EFQTSVVSWDIDTAAKFI |
Parental | GAGAATVG |
.AGA.T.G | |
Retrocopy | DAGAITIG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 59 .86 RPM |
SRP007412_cerebellum | 0 .00 RPM | 33 .02 RPM |
SRP007412_heart | 0 .03 RPM | 180 .82 RPM |
SRP007412_kidney | 0 .05 RPM | 93 .05 RPM |
SRP007412_liver | 0 .00 RPM | 46 .74 RPM |
SRP007412_testis | 0 .00 RPM | 14 .33 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2844 |
Pongo abelii | retro_pabe_2353 |
Callithrix jacchus | retro_cjac_1549 |