RetrogeneDB ID: | retro_pabe_2353 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 3:141394722..141394956(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ATP5G1 | ||
| Ensembl ID: | ENSPPYG00000008909 | ||
| Aliases: | None | ||
| Description: | ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C1 (subunit 9) [Source:HGNC Symbol;Acc:841] |
| Percent Identity: | 71.79 % |
| Parental protein coverage: | 57.35 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MQTAGALFISPALIRCCTRGLIRPVSASFLNSPVNSSKQPSYSNFPLQVARREFQTSVVSRDIDTAAKFI |
| MQT.GAL..S.ALI.C.TR.L.R.VSASFLN.P.N.SKQ.SYS..PL.VAR.EFQTSVVS.DIDTA.KFI | |
| Retrocopy | MQTLGALLVSQALICCSTRDLLRSVSASFLNRPNNLSKQLSYSSSPLHVAR*EFQTSVVSWDIDTAVKFI |
| Parental | GAGAATVG |
| .AGA.T.G | |
| Retrocopy | DAGAITIG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 42 .19 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 20 .31 RPM |
| SRP007412_heart | 0 .00 RPM | 72 .13 RPM |
| SRP007412_kidney | 0 .00 RPM | 62 .55 RPM |
| SRP007412_liver | 0 .03 RPM | 32 .56 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2844 |
| Pan troglodytes | retro_ptro_1926 |
| Callithrix jacchus | retro_cjac_1549 |