RetrogeneDB ID: | retro_btau_1531 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
Coordinates: | 7:40193692..40193889(+) | ||
Located in intron of: | ENSBTAG00000008034 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPL37A | ||
Ensembl ID: | ENSBTAG00000003846 | ||
Aliases: | None | ||
Description: | 60S ribosomal protein L37a [Source:UniProtKB/Swiss-Prot;Acc:Q3MIC0] |
Percent Identity: | 66.18 % |
Parental protein coverage: | 72.83 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | SLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVT-VKSAIRRLK |
S.RKMVK..EISQH.K.TCS.C.KTKMKR.A.GI..CGS...TVAGGA.T..TTSA.T..KS...RLK | |
Retrocopy | SFRKMVKRMEISQHNKHTCS-CDKTKMKRQAAGICCCGSFERTVAGGA*TNATTSAIT<RKSGL*RLK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
ERP005899_liver | 0 .07 RPM | 245 .27 RPM |
ERP005899_muscle | 0 .05 RPM | 776 .84 RPM |
SRP017611_brain | 0 .05 RPM | 70 .89 RPM |
SRP017611_kidney | 0 .06 RPM | 207 .75 RPM |
SRP017611_liver | 0 .08 RPM | 128 .97 RPM |
SRP030211_testis | 0 .02 RPM | 95 .87 RPM |