RetrogeneDB ID: | retro_rnor_1136 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 15:12672702..12672929(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | H2afz | ||
| Ensembl ID: | ENSRNOG00000010306 | ||
| Aliases: | None | ||
| Description: | Histone H2A.Z [Source:UniProtKB/Swiss-Prot;Acc:P0C0S7] |
| Percent Identity: | 84.42 % |
| Parental protein coverage: | 59.84 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | AGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHR-HLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELA |
| AG..AGKDSGKAKTKAVSRSQ.AGLQFPVG.IH..H.KSRTTS.GRV.ATAAVYSAA.LE.LTAEVLELA | |
| Retrocopy | AGSEAGKDSGKAKTKAVSRSQ*AGLQFPVGCIHD<HPKSRTTSQGRVVATAAVYSAAVLEFLTAEVLELA |
| Parental | GNASKDL |
| GNASKD. | |
| Retrocopy | GNASKDV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .07 RPM | 33 .00 RPM |
| SRP017611_kidney | 0 .00 RPM | 31 .89 RPM |
| SRP017611_liver | 0 .00 RPM | 17 .21 RPM |