RetrogeneDB ID: | retro_fcat_956 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
Coordinates: | B4:46745508..46745723(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPL34 | ||
Ensembl ID: | ENSFCAG00000015502 | ||
Aliases: | None | ||
Description: | ribosomal protein L34 [Source:HGNC Symbol;Acc:10340] |
Percent Identity: | 71.23 % |
Parental protein coverage: | 61.54 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAP-KSACGVCPGRLRGVRAVRPKVLMRLSK |
MVQRLTYRRRLS..TASN.TRLS.TPGNR..YLYTKKVGK.P.KS.CG.C.G.L....AV.PKVLM..S. | |
Retrocopy | MVQRLTYRRRLSDYTASNETRLSQTPGNRVIYLYTKKVGKTP<KSLCGMCQG*L*RFCAVGPKVLMGWSR |
Parental | TKK |
.KK | |
Retrocopy | MKK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 56 .47 RPM |
SRP017611_kidney | 0 .00 RPM | 179 .11 RPM |
SRP017611_liver | 0 .00 RPM | 84 .61 RPM |