RetrogeneDB ID: | retro_rnor_1695 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
Coordinates: | 2:232767912..232768133(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Rpl34 | ||
Ensembl ID: | ENSRNOG00000016387 | ||
Aliases: | Rpl34, Rpl34l2 | ||
Description: | 60S ribosomal protein L34 [Source:RefSeq peptide;Acc:NP_001102037] |
Percent Identity: | 64. % |
Parental protein coverage: | 63.25 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | SACGVCPGRLRGVRAVRPKVLMRLSKTK-KHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVLKAQAQ |
S.CG....R..GV.A.R.KVLMRLS..K..HVSRA.G.S..AKCV.DRI....L.E.QKI.VKVLKAQAQ | |
Retrocopy | SVCGMYSKRVQGVHAERLKVLMRLSEMK<NHVSRARGVSTGAKCVHDRIQCEPLTEKQKIIVKVLKAQAQ |
Parental | SQKAK |
SQ.AK | |
Retrocopy | SQRAK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 49 .11 RPM |
SRP017611_kidney | 0 .00 RPM | 73 .69 RPM |
SRP017611_liver | 0 .00 RPM | 44 .58 RPM |
Species | RetrogeneDB ID |
---|---|
Mus musculus | retro_mmus_2290 |
Rattus norvegicus | retro_rnor_1694 |
Rattus norvegicus | retro_rnor_1696 |