RetrogeneDB ID: | retro_mmus_2290 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 3:110277135..110277363(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Rpl34 | ||
| Ensembl ID: | ENSMUSG00000062006 | ||
| Aliases: | Rpl34, 1100001I22Rik | ||
| Description: | ribosomal protein L34 [Source:MGI Symbol;Acc:MGI:1915686] |
| Percent Identity: | 61.84 % |
| Parental protein coverage: | 64.96 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | PKSACGVCPGRLRGVRAVRPKVLMRLSKTQKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVLKAQA |
| P.S.CG....RL..V.AVRPKVLMRLSK...HVSRA.G.S....CV.D.I...FL.E.QKI.VKVLKAQ. | |
| Retrocopy | PTSVCGMYSSRLQAVHAVRPKVLMRLSKMKNHVSRACGVSTGTNCVHDEIQCEFLTEKQKIIVKVLKAQS |
| Parental | QSQKAK |
| .SQ.AK | |
| Retrocopy | *SQRAK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 41 .14 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 24 .40 RPM |
| SRP007412_heart | 0 .00 RPM | 40 .38 RPM |
| SRP007412_kidney | 0 .00 RPM | 42 .08 RPM |
| SRP007412_liver | 0 .00 RPM | 45 .41 RPM |
| SRP007412_testis | 0 .00 RPM | 39 .75 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Rattus norvegicus | retro_rnor_1694 |
| Rattus norvegicus | retro_rnor_1696 |
| Rattus norvegicus | retro_rnor_1695 |