RetrogeneDB ID: | retro_mmus_882 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
Coordinates: | 12:85957395..85957609(+) | ||
Located in intron of: | ENSMUSG00000012609 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Rpl34 | ||
Ensembl ID: | ENSMUSG00000062006 | ||
Aliases: | Rpl34, 1100001I22Rik | ||
Description: | ribosomal protein L34 [Source:MGI Symbol;Acc:MGI:1915686] |
Percent Identity: | 65.33 % |
Parental protein coverage: | 62.39 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | RLSYNTASNKTRLSRTPGNRIVYLYTKK-VGKAPKSACGV-CPGRLRGVRAVRPKVLMRLSKTQKHVSRA |
RLS..T.SNKT.LS..PGNRI...YT...VGK.P.SACGV.....LRG.RAVRPKVL.RLSKT.K.VSRA | |
Retrocopy | RLSCSTVSNKTSLSSNPGNRILF-YTRR<VGKGPTSACGV<AQADLRGARAVRPKVLRRLSKTKKCVSRA |
Parental | YGGSM |
.G.S. | |
Retrocopy | CGASV |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 41 .14 RPM |
SRP007412_cerebellum | 0 .00 RPM | 24 .40 RPM |
SRP007412_heart | 0 .00 RPM | 40 .38 RPM |
SRP007412_kidney | 0 .00 RPM | 42 .08 RPM |
SRP007412_liver | 0 .00 RPM | 45 .41 RPM |
SRP007412_testis | 0 .27 RPM | 39 .75 RPM |