RetrogeneDB ID: | retro_cfam_1630 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
Coordinates: | 38:19928619..19928996(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPL15 | ||
Ensembl ID: | ENSCAFG00000005764 | ||
Aliases: | None | ||
Description: | 60S ribosomal protein L15 [Source:UniProtKB/Swiss-Prot;Acc:E2QXF3] |
Percent Identity: | 73.23 % |
Parental protein coverage: | 61.27 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | LHRAPRPTRPDKARRLGYKAKQGYVIYRIRVRRGGRKRPVPKGATYGKPVHHGVNQLKFARSLQSVAEER |
.HRAP.PTR.DK..RLG.KAKQGYV..R..V..GG.K.PVPKGA.Y.KP.HHGVNQLKFA.SLQSVAEE. | |
Retrocopy | VHRAPHPTRADKVHRLGSKAKQGYVVCRVHVHCGGHKHPVPKGAVYSKPAHHGVNQLKFAQSLQSVAEE* |
Parental | AGRHC-GALRVLN-SYWVGEDSTYKFFEVILIDPFHKAIRRNPDTQWITKPVHKHRE |
AG.H..GALRV.N.SY.VGEDSTYKFFEVILI.P..KAIR.NP.TQ..TK.V.KHRE | |
Retrocopy | AGCHV<GALRVANSSY*VGEDSTYKFFEVILIEPLCKAIRGNPYTQGTTKAVYKHRE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012049_cerebellum | 0 .00 RPM | 286 .22 RPM |
SRP017611_brain | 0 .00 RPM | 122 .03 RPM |
SRP017611_kidney | 0 .00 RPM | 858 .88 RPM |
SRP017611_liver | 0 .00 RPM | 126 .39 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000033080 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000005764 | 5 retrocopies | |
Cavia porcellus | ENSCPOG00000002253 | 4 retrocopies | |
Felis catus | ENSFCAG00000026237 | 6 retrocopies | |
Homo sapiens | ENSG00000174748 | 14 retrocopies | |
Gorilla gorilla | ENSGGOG00000024274 | 13 retrocopies | |
Myotis lucifugus | ENSMLUG00000013809 | 15 retrocopies | |
Macaca mulatta | ENSMMUG00000006353 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000014880 | 3 retrocopies | |
Mustela putorius furo | ENSMPUG00000012148 | 7 retrocopies | |
Mus musculus | ENSMUSG00000012405 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000003580 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000010961 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000013056 | 13 retrocopies | |
Procavia capensis | ENSPCAG00000011995 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000008140 | 17 retrocopies | |
Sus scrofa | ENSSSCG00000028079 | 5 retrocopies | |
Tursiops truncatus | ENSTTRG00000007244 | 5 retrocopies |