RetrogeneDB ID: | retro_cjac_722 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 10:95014392..95014746(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MRPL42 | ||
| Ensembl ID: | ENSCJAG00000032825 | ||
| Aliases: | None | ||
| Description: | mitochondrial ribosomal protein L42 [Source:HGNC Symbol;Acc:14493] |
| Percent Identity: | 91.6 % |
| Parental protein coverage: | 84.4 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | DGALYCVCHKSTYSPLPDDYNCKVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNNEETHDQILK |
| .GALYCVCHKSTYSPLPDDYNCKV.LALTSDGRTIVCYHPSVDIPYEHTKPIP.PDPVH.NEETH.QILK | |
| Retrocopy | NGALYCVCHKSTYSPLPDDYNCKVKLALTSDGRTIVCYHPSVDIPYEHTKPIPWPDPVH-NEETHHQILK |
| Parental | TRLEEKVEPLEQGPMIEQLSKMFFTTKHRWYPYGRYHRCRKNPNPPKDR |
| .RLEEKVEPLEQGPM.EQLSKMFFTTKH.W.PYGRYHRCRKNPN.PKDR | |
| Retrocopy | MRLEEKVEPLEQGPMVEQLSKMFFTTKHCWCPYGRYHRCRKNPNLPKDR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 15 .38 RPM |
| SRP051959_heart | 0 .04 RPM | 24 .29 RPM |
| SRP051959_kidney | 0 .00 RPM | 17 .02 RPM |
| SRP051959_liver | 0 .02 RPM | 16 .92 RPM |
| SRP051959_lung | 0 .08 RPM | 14 .79 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 10 .82 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 28 .52 RPM |
| SRP051959_spleen | 0 .06 RPM | 13 .95 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000009832 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000002708 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000032825 | 4 retrocopies | |
| Homo sapiens | ENSG00000198015 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000022760 | 5 retrocopies | |
| Loxodonta africana | ENSLAFG00000013779 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000016805 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000005699 | 5 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000010928 | 7 retrocopies | |
| Ochotona princeps | ENSOPRG00000010967 | 5 retrocopies | |
| Procavia capensis | ENSPCAG00000003791 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000004833 | 7 retrocopies | |
| Pan troglodytes | ENSPTRG00000022791 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000042740 | 4 retrocopies | |
| Sus scrofa | ENSSSCG00000030478 | 4 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000026544 | 12 retrocopies | |
| Tarsius syrichta | ENSTSYG00000006370 | 3 retrocopies | |
| Tursiops truncatus | ENSTTRG00000003312 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000007658 | 1 retrocopy |